PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_11052_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family SBP
Protein Properties Length: 461aa    MW: 52322.7 Da    PI: 7.2938
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_11052_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1314.2e-41174250177
                                           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT------ CS
                                   SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerr 73 
                                           +Cqv+gC +dls+ k+y++rh+vC++hsk+++v+++g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerr
  cra_locus_11052_iso_3_len_2224_ver_3 174 ICQVQGCYKDLSSSKDYYKRHRVCDIHSKTAKVVINGIEQRFCQQCSRFHLLVEFDNGKRSCRKRLAGHNERR 246
                                           5************************************************************************ PP

                                           -S-- CS
                                   SBP  74 rkkq 77 
                                           rk+q
  cra_locus_11052_iso_3_len_2224_ver_3 247 RKPQ 250
                                           **97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.9E-33171236IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.65172249IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-38173252IPR004333Transcription factor, SBP-box
PfamPF031103.6E-31175248IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    Send to blast
MEFQELYWEN KSSVFLDNIE FPIDVLVRNK NFVRNLEIKD LCDFDKDGLD LDRETVDDIG  60
FIETIFHHGM SKSALDSPGF GVSSGEISDS SINKVTSTSI INLGHSTKEM GFGTVFEHNN  120
EKESMIGKEL DKYADSKEVS SMLSSEESLI SSLMEHSLPT KRARNTGLYP QIPICQVQGC  180
YKDLSSSKDY YKRHRVCDIH SKTAKVVING IEQRFCQQCS RFHLLVEFDN GKRSCRKRLA  240
GHNERRRKPQ LGAHLGSRFF EMTLLRSTSF RSSETLPGSF YYQERNVCYD HSSKHIKLEQ  300
VPIDISQLAE PENGQSPSNS RPILHLIRNQ HYLETCNDGP VELELPMLPD SRCALSLLSA  360
NSHNNHSMGV SKRTSPSTRE NQNTLVGVYQ KSAKAFTGNR HFSSGTQNQV GSPMVRSGFQ  420
KDGHIQTSDY TMDLFQLSSH LQRVEKLKSD MQMKQESYSS S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-28172248884squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A068TVY41e-116A0A068TVY4_COFCA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68311933